PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10016769
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 283aa    MW: 31119.2 Da    PI: 6.504
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10016769genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.13.1e-4371071101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp eqp+kfa vh++FGasnv kll+++p  +reda++sl+yeA+ar+rdPvyG+vg+i+ lq++l+ql+ +l+++k
  Lus10016769   7 PCAACKFLRRKCTQECVFAPYFPPEQPAKFASVHRVFGASNVAKLLNEIPAGQREDAVNSLAYEADARLRDPVYGCVGLISILQHKLKQLHIDLDTAK 104
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  +el
  Lus10016769 105 QEL 107
                  975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7766107IPR004883Lateral organ boundaries, LOB
PfamPF031956.0E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MSSQNSPCAA CKFLRRKCTQ ECVFAPYFPP EQPAKFASVH RVFGASNVAK LLNEIPAGQR  60
EDAVNSLAYE ADARLRDPVY GCVGLISILQ HKLKQLHIDL DTAKQELSKY IDPQAMLPNL  120
GSVVSPSYIA AGMNMMMMMP PNHHHQNMMP MMPIPTDDIN TNEQQLHHQQ IYAAQQLTAT  180
AEIVPQQQQQ QQQQQRFEQE GIRIIDGGGG GEAVSGTAGL NLNQIRSPIS TTASLALGTS  240
RDNRAYQVEL KPVVYHVQPH NLEGRSSECS TAGDDEGRSI ER*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079177.11e-73PREDICTED: LOB domain-containing protein 36-like
RefseqXP_012079178.11e-73PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-71LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0B0PS926e-78A0A0B0PS92_G
STRINGPOPTR_0007s11460.12e-72(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-67ASYMMETRIC LEAVES 2-like 1